PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009609606.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 758aa    MW: 83732 Da    PI: 6.4725
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009609606.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.6e-2090145156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe++F+++++p+ ++r++L k+lgL+  q+k+WFqN+R+++k
  XP_009609606.1  90 KKQYHRHTQHQIQELEAFFKECPHPDDKQRKDLGKRLGLEPLQIKFWFQNKRTQMK 145
                     688999***********************************************998 PP

2START220.17.1e-692774981206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++el+++a+ +ep+W +ss    e++ ++e+ ++f+++ +      ++ea+r+s+vv+m++ +lve+l+d++ qW+  +a    ka+tl
  XP_009609606.1 277 ELAVAAMEELIRLAETREPLWIQSSensaEILSEEEYARTFPRGVGpkslgLKSEASRESAVVIMNHINLVEILMDVN-QWTSFFAglvsKATTL 370
                     57899********************99999***********99777********************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     ev+s+g      galq+m+ae+q++splvp R+ +fvRy++q+ +g+w++vdvS+d+ ++ +    v R++++pSg+li++++ng+sk+tw+ehv
  XP_009609606.1 371 EVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQHADGTWAVVDVSLDNLRPTS---VVSRCRRRPSGCLIQELPNGYSKITWIEHV 462
                     ***********************************************************966...5***************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++r +h+++r+lv+sgla+gak+wvatl+rqce+
  XP_009609606.1 463 EVDDRAVHSIYRPLVNSGLAFGAKRWVATLDRQCER 498
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.63E-1876146IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-2078148IPR009057Homeodomain-like
PROSITE profilePS5007116.27787147IPR001356Homeobox domain
SMARTSM003897.1E-1889151IPR001356Homeobox domain
CDDcd000861.50E-1790148No hitNo description
PfamPF000461.5E-1790145IPR001356Homeobox domain
SuperFamilySSF559615.22E-39268500No hitNo description
PROSITE profilePS5084847.734268501IPR002913START domain
CDDcd088751.38E-129272497No hitNo description
SMARTSM002341.2E-69277498IPR002913START domain
PfamPF018523.7E-58278498IPR002913START domain
Gene3DG3DSA:3.30.530.203.2E-7346498IPR023393START-like domain
SuperFamilySSF559612.13E-24516750No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MCLHLRTYLP FHSPNDLKSL VSFAKKEKFV KMFQQNMFDS HNFLLDLSHK TSENEMDLIR  60
DDEFESKSGA DTTELAPSGD DQDPNKRPKK KQYHRHTQHQ IQELEAFFKE CPHPDDKQRK  120
DLGKRLGLEP LQIKFWFQNK RTQMKAHHER HENTQLRNEN EKLRAENIRY KEALSTATCP  180
NCGGPAAIGE MSFDEQHLRI ENARLREEID RISGIAAKYV GKPMLNYPQL PSPIPPTRSL  240
DLGVASFGHQ LGEMYNAGDL LRSISGPTDA DKPMIIELAV AAMEELIRLA ETREPLWIQS  300
SENSAEILSE EEYARTFPRG VGPKSLGLKS EASRESAVVI MNHINLVEIL MDVNQWTSFF  360
AGLVSKATTL EVLSTGVAGN YNGALQVMTA EFQVPSPLVP TRENYFVRYC KQHADGTWAV  420
VDVSLDNLRP TSVVSRCRRR PSGCLIQELP NGYSKITWIE HVEVDDRAVH SIYRPLVNSG  480
LAFGAKRWVA TLDRQCERLA SVMANNIPTG DVITSPEGRK SMLKLAERMV MSFCAGVGAS  540
TAHTWTTLSG SGADDVRVMT RKSIDDPGRP PGIVLSAATS FWLPVPTKRV FDFLRNENSR  600
NEWDILSNGG LVQEMAHIAN GRDSGNSVSL LRVNSGNSSQ NNMLILQESC TDSTGSYVIY  660
APVDIAAMNV VLSGGDPDYV ALLPSGFAIL PDGSATTNGV GINLETNSAG GSLLTVAFQI  720
LVDSVPTAKL SLGSVATVNS LIKCTVERIK ASIVCESA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009609606.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2-like isoform X1
RefseqXP_016458396.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2-like isoform X1
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLK4CX660.0K4CX66_SOLLC; Uncharacterized protein
STRINGSolyc10g005330.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein